PDB entry 2yzu
View 2yzu on RCSB PDB site
Description: Crystal structure of oxidized thioredoxin from Thermus thermophilus HB8
Class: electron transport
Keywords: Redox protein, ELECTRON TRANSPORT, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on
2007-05-06, released
2007-11-06
The last revision prior to the SCOPe 2.05 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.25
AEROSPACI score: 0.43
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: thioredoxin
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d2yzua_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2yzuA (A:)
akpievtdqnfdetlgqhplvlvdfwaewcapcrmiapileeiakeyegkllvakldvde
npktamryrvmsiptvilfkdgqpvevlvgaqpkrnyqakiekhlpata
Sequence, based on observed residues (ATOM records): (download)
>2yzuA (A:)
kpievtdqnfdetlgqhplvlvdfwaewcapcrmiapileeiakeyegkllvakldvden
pktamryrvmsiptvilfkdgqpvevlvgaqpkrnyqakiekhl