PDB entry 2yzu

View 2yzu on RCSB PDB site
Description: Crystal structure of oxidized thioredoxin from Thermus thermophilus HB8
Class: electron transport
Keywords: Redox protein, ELECTRON TRANSPORT, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-05-06, released 2007-11-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.25
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: thioredoxin
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SHI3
  Domains in SCOPe 2.05: d2yzua_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2yzuA (A:)
  akpievtdqnfdetlgqhplvlvdfwaewcapcrmiapileeiakeyegkllvakldvde
  npktamryrvmsiptvilfkdgqpvevlvgaqpkrnyqakiekhlpata
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2yzuA (A:)
  kpievtdqnfdetlgqhplvlvdfwaewcapcrmiapileeiakeyegkllvakldvden
  pktamryrvmsiptvilfkdgqpvevlvgaqpkrnyqakiekhl