SCOPe 2.05: Domain d2yzua_: 2yzu A:

Lineage for d2yzua_ (2yzu A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (147 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [188264] (2 PDB entries)

8. Domain d2yzua_: 2yzu A: [170945]
   automated match to d1nw2a_

Details for d2yzua_

PDB Entry: 2yzu, 1.9 Å

PDB Description: crystal structure of oxidized thioredoxin from thermus thermophilus hb8

PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d2yzua_:

Sequence; same for both SEQRES and ATOM records:

>d2yzua_ c.47.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
kpievtdqnfdetlgqhplvlvdfwaewcapcrmiapileeiakeyegkllvakldvden
pktamryrvmsiptvilfkdgqpvevlvgaqpkrnyqakiekhl

Timeline for d2yzua_:

• d2yzua_ first appeared in SCOPe 2.01
  
• d2yzua_ appears in SCOPe 2.04
  
• d2yzua_ appears in SCOPe 2.06
  
• d2yzua_ appears in the current release, SCOPe 2.08