PDB entry 2yxs

View 2yxs on RCSB PDB site
Description: Crystal Sturcture of N-terminal domain of human galectin-8 with D-lactose
Class: sugar binding protein
Keywords: suger-binding, lactose, galectin, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SUGAR BINDING PROTEIN
Deposited on 2007-04-27, released 2008-05-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.13 Å
R-factor: 0.19
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galectin-8 variant
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59E97 (Start-157)
      • expression tag (158-163)
    Domains in SCOPe 2.07: d2yxsa1, d2yxsa2
  • Heterogens: LAT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2yxsA (A:)
gssgssgmmlslnnlqniiynpvipyvgtipdqldpgtlivicghvpsdadrfqvdlqng
ssvkpradvafhfnprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdk
fqvavngkhtllyghrigpekidtlgiygkvnihsigfsgpssg

    Sequence, based on observed residues (ATOM records): (download) 
    >2yxsA (A:)
lqniiynpvipyvgtipdqldpgtlivicghvpsdadrfqvdlqngssvkpradvafhfn
prfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavngkhtllyg
hrigpekidtlgiygkvnihsigfsgpssg