PDB entry 2yuy

View 2yuy on RCSB PDB site
Description: Solution Structure of PDZ domain of Rho GTPase Activating Protein 21
Class: signaling protein
Keywords: PDZ domain, Rho GTPase activating protein 21, NMR, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2007-04-06, released 2008-04-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Rho GTPase activating protein 21
  Species: Homo sapiens [TaxId:9606]
  Gene: ARHGAP21
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5T5U3 (7-119)
    • expression tag (0-6)
    • expression tag (120-125)
  Domains in SCOPe 2.04: d2yuya_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2yuyA (A:)
  gssgssggpktvtlkrtsqgfgftlrhfivyppesaiqfsykdeengnrggkqrnrlepm
  dtifvkqvkeggpafeaglctgdriikvngesvigktysqvialiqnsdttlelsvmpkd
  sgpssg