PDB entry 2ysg

View 2ysg on RCSB PDB site
Description: Solution structure of the WW domain from the human syntaxin-binding protein 4
Class: protein binding
Keywords: Synip, STXBP4, WW domain, NMR, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2007-04-03, released 2007-10-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Syntaxin-binding protein 4
  Species: Homo sapiens [TaxId:9606]
  Gene: STXBP4
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6ZWJ1 (7-39)
    • expression tag (0-6)
  Domains in SCOPe 2.06: d2ysga2, d2ysga3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ysgA (A:)
  gssgssglpygweeaytadgikyfinhvtqttswihpvms