PDB entry 2yrk

View 2yrk on RCSB PDB site
Description: Solution structure of the zf-C2H2 domain in zinc finger homeodomain 4
Class: transcription
Keywords: NMR, structure genomics, zf-C2H2 domain, ZFH-4, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2007-04-02, released 2007-10-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Zinc finger homeobox protein 4
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9JJN2 (7-54)
    • expression tag (0-6)
  Domains in SCOPe 2.07: d2yrka1, d2yrka2
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2yrkA (A:)
  gssgssggtdgtkpectlcgvkysarlsirdhifskqhiskvretvgsqldrekd