PDB entry 2yrh

View 2yrh on RCSB PDB site
Description: Solution structure of the C2H2-type zinc finger domain (699-729) from zinc finger protein 473
Class: cell cycle
Keywords: C2H2-type zinc fingers, Zinc finger protein 473, Zinc finger protein 100 homolog Zfp-100, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CELL CYCLE
Deposited on 2007-04-02, released 2007-10-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc finger protein 473
    Species: Homo sapiens [TaxId:9606]
    Gene: ZNF473
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WTR7 (7-37)
      • expression tag (0-6)
      • expression tag (38-43)
    Domains in SCOPe 2.06: d2yrha1, d2yrha2, d2yrha3
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2yrhA (A:)
    gssgssgkkplvcnecgktfrqssclskhqrihsgekpsgpssg