PDB entry 2yhf

View 2yhf on RCSB PDB site
Description: 1.9 angstrom crystal structure of clec5a
Class: immune system
Keywords: immune system
Deposited on 2011-04-30, released 2011-05-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.219
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: c-type lectin domain family 5 member a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NY25 (0-117)
      • engineered mutation (0)
    Domains in SCOPe 2.07: d2yhfa_
  • Chain 'B':
    Compound: c-type lectin domain family 5 member a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NY25 (0-117)
      • engineered mutation (0)
    Domains in SCOPe 2.07: d2yhfb_
  • Chain 'C':
    Compound: c-type lectin domain family 5 member a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NY25 (0-117)
      • engineered mutation (0)
    Domains in SCOPe 2.07: d2yhfc_
  • Chain 'D':
    Compound: c-type lectin domain family 5 member a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NY25 (0-117)
      • engineered mutation (0)
    Domains in SCOPe 2.07: d2yhfd_
  • Chain 'E':
    Compound: c-type lectin domain family 5 member a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NY25 (0-117)
      • engineered mutation (0)
    Domains in SCOPe 2.07: d2yhfe_
  • Chain 'F':
    Compound: c-type lectin domain family 5 member a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NY25 (0-117)
      • engineered mutation (0)
    Domains in SCOPe 2.07: d2yhff_
  • Chain 'G':
    Compound: c-type lectin domain family 5 member a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NY25 (0-117)
      • engineered mutation (0)
    Domains in SCOPe 2.07: d2yhfg_
  • Chain 'H':
    Compound: c-type lectin domain family 5 member a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NY25 (0-117)
      • engineered mutation (0)
    Domains in SCOPe 2.07: d2yhfh_
  • Chain 'I':
    Compound: c-type lectin domain family 5 member a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NY25 (0-117)
      • engineered mutation (0)
    Domains in SCOPe 2.07: d2yhfi_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2yhfA (A:)
mcpkdwefyqarcfflstsesswnesrdfckgkgstlaivntpeklkflqditdaekyfi
gliyhreekrwrwinnsvfngnvtnqnqnfncatigltktfdaascdisyrricekna

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2yhfB (B:)
mcpkdwefyqarcfflstsesswnesrdfckgkgstlaivntpeklkflqditdaekyfi
gliyhreekrwrwinnsvfngnvtnqnqnfncatigltktfdaascdisyrricekna

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2yhfC (C:)
mcpkdwefyqarcfflstsesswnesrdfckgkgstlaivntpeklkflqditdaekyfi
gliyhreekrwrwinnsvfngnvtnqnqnfncatigltktfdaascdisyrricekna

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2yhfD (D:)
mcpkdwefyqarcfflstsesswnesrdfckgkgstlaivntpeklkflqditdaekyfi
gliyhreekrwrwinnsvfngnvtnqnqnfncatigltktfdaascdisyrricekna

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2yhfE (E:)
mcpkdwefyqarcfflstsesswnesrdfckgkgstlaivntpeklkflqditdaekyfi
gliyhreekrwrwinnsvfngnvtnqnqnfncatigltktfdaascdisyrricekna

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2yhfF (F:)
mcpkdwefyqarcfflstsesswnesrdfckgkgstlaivntpeklkflqditdaekyfi
gliyhreekrwrwinnsvfngnvtnqnqnfncatigltktfdaascdisyrricekna

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2yhfG (G:)
mcpkdwefyqarcfflstsesswnesrdfckgkgstlaivntpeklkflqditdaekyfi
gliyhreekrwrwinnsvfngnvtnqnqnfncatigltktfdaascdisyrricekna

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2yhfH (H:)
mcpkdwefyqarcfflstsesswnesrdfckgkgstlaivntpeklkflqditdaekyfi
gliyhreekrwrwinnsvfngnvtnqnqnfncatigltktfdaascdisyrricekna

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2yhfI (I:)
mcpkdwefyqarcfflstsesswnesrdfckgkgstlaivntpeklkflqditdaekyfi
gliyhreekrwrwinnsvfngnvtnqnqnfncatigltktfdaascdisyrricekna