PDB entry 2yfv

View 2yfv on RCSB PDB site
Description: the heterotrimeric complex of kluyveromyces lactis scm3, cse4 and h4
Class: cell cycle
Keywords: cell cycle, kinetochore, centromere, histone chaperone, budding yeast
Deposited on 2011-04-08, released 2011-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-06-22, with a file datestamp of 2011-06-17.
Experiment type: XRAY
Resolution: 2.32 Å
R-factor: 0.22195
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histone h3-like centromeric protein cse4
    Species: KLUYVEROMYCES LACTIS NRRL Y-1140 [TaxId:284590]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yfva_
  • Chain 'B':
    Compound: histone h4
    Species: KLUYVEROMYCES LACTIS NRRL Y-1140 [TaxId:284590]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yfvb_
  • Chain 'C':
    Compound: scm3
    Species: KLUYVEROMYCES LACTIS NRRL Y-1140 [TaxId:284590]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yfvA (A:)
    kargtrykptdlalaeirkyqrstdllisrmpfarlvkevtdqftteseplrwqsmaima
    lqeaseaylvgllehtnllalhakritimrkdmqlarrir
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yfvA (A:)
    isrmpfarlvkevtdqftlrwqsmaimalqeaseaylvgllehtnllalhakritimrkd
    mqlarrir
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2yfvB (B:)
    dniqgitkpairrlarrggvkrisgliyeevrnvlktflesvirdavtytehakrktvts
    ldvvyalkrqgrtl
    

  • Chain 'C':
    No sequence available.