PDB entry 2yfv

View 2yfv on RCSB PDB site
Description: the heterotrimeric complex of kluyveromyces lactis scm3, cse4 and h4
Class: cell cycle
Keywords: cell cycle, kinetochore, centromere, histone chaperone, budding yeast
Deposited on 2011-04-08, released 2011-05-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-06-22, with a file datestamp of 2011-06-17.
Experiment type: XRAY
Resolution: 2.32 Å
R-factor: 0.22195
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: histone h3-like centromeric protein cse4
  Species: KLUYVEROMYCES LACTIS NRRL Y-1140 [TaxId:284590]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6CTI2 (Start-99)
  Domains in SCOPe 2.08: d2yfva_
• Chain 'B':
  Compound: histone h4
  Species: KLUYVEROMYCES LACTIS NRRL Y-1140 [TaxId:284590]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6CMU6 (0-73)
  Domains in SCOPe 2.08: d2yfvb_
• Chain 'C':
  Compound: scm3
  Species: KLUYVEROMYCES LACTIS NRRL Y-1140 [TaxId:284590]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6CL77 (Start-62)
• Heterogens: IOD, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2yfvA (A:)
  kargtrykptdlalaeirkyqrstdllisrmpfarlvkevtdqftteseplrwqsmaima
  lqeaseaylvgllehtnllalhakritimrkdmqlarrir
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2yfvA (A:)
  isrmpfarlvkevtdqftlrwqsmaimalqeaseaylvgllehtnllalhakritimrkd
  mqlarrir
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2yfvB (B:)
  dniqgitkpairrlarrggvkrisgliyeevrnvlktflesvirdavtytehakrktvts
  ldvvyalkrqgrtl
  

  
  
• Chain 'C':
  No sequence available.