![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
![]() | Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
![]() | Protein automated matches [193445] (8 species) not a true protein |
![]() | Species Kluyveromyces lactis [TaxId:284590] [226140] (3 PDB entries) |
![]() | Domain d2yfva_: 2yfv A: [198754] Other proteins in same PDB: d2yfvb_ automated match to d2pyoa_ complexed with iod |
PDB Entry: 2yfv (more details), 2.32 Å
SCOPe Domain Sequences for d2yfva_:
Sequence, based on SEQRES records: (download)
>d2yfva_ a.22.1.1 (A:) automated matches {Kluyveromyces lactis [TaxId: 284590]} isrmpfarlvkevtdqftteseplrwqsmaimalqeaseaylvgllehtnllalhakrit imrkdmqlarrir
>d2yfva_ a.22.1.1 (A:) automated matches {Kluyveromyces lactis [TaxId: 284590]} isrmpfarlvkevtdqftlrwqsmaimalqeaseaylvgllehtnllalhakritimrkd mqlarrir
Timeline for d2yfva_: