PDB entry 2yb8

View 2yb8 on RCSB PDB site
Description: crystal structure of nurf55 in complex with su(z)12
Class: transcription
Keywords: transcription, histone methlyation, chromatin remodelling, p55, rbbp4, rbbp7, rbap46, rbap48, prc2, h4, h3k27, h3k4, wd40 domain
Deposited on 2011-03-02, released 2011-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-05-18, with a file datestamp of 2011-05-13.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.1748
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: polycomb protein su(z)12
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: probable histone-binding protein caf1
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yb8b_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2yb8B (B:)
    gggrmvdrsdnaaesfddaveervineeykiwkkntpflydlvmthalewpsltaqwlpd
    vtkqdgkdysvhrlilgthtsdeqnhlliasvqlpsedaqfdgshydnekgefggfgsvc
    gkieieikinhegevnrarympqnacviatktpssdvlvfdytkhpskpepsgecqpdlr
    lrghqkegyglswnpnlngyllsasddhticlwdinatpkehrvidakniftghtavved
    vawhllheslfgsvaddqklmiwdtrnnntskpshtvdahtaevnclsfnpysefilatg
    sadktvalwdlrnlklklhsfeshkdeifqvqwsphnetilassgtdrrlhvwdlskige
    eqstedaedgppellfihgghtakisdfswnpnepwiicsvsednimqvwqmaenvynde
    ep
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yb8B (B:)
    veervineeykiwkkntpflydlvmthalewpsltaqwlpdvtkqdgkdysvhrlilgth
    tsdeqnhlliasvqlpsgkieieikinhegevnrarympqnacviatktpssdvlvfdyt
    khpskpepsgecqpdlrlrghqkegyglswnpnlngyllsasddhticlwdinatpkehr
    vidakniftghtavvedvawhllheslfgsvaddqklmiwdtrnnntskpshtvdahtae
    vnclsfnpysefilatgsadktvalwdlrnlklklhsfeshkdeifqvqwsphnetilas
    sgtdrrlhvwdlskigeeqstedaedgppellfihgghtakisdfswnpnepwiicsvse
    dnimqvwqmaenvyn