![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.69.4: WD40 repeat-like [50978] (4 families) ![]() also contains 8-bladed propellers |
![]() | Family b.69.4.1: WD40-repeat [50979] (17 proteins) this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain |
![]() | Protein automated matches [190346] (4 species) not a true protein |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [311262] (1 PDB entry) |
![]() | Domain d2yb8b_: 2yb8 B: [304709] automated match to d3c9ca_ complexed with so4 |
PDB Entry: 2yb8 (more details), 2.3 Å
SCOPe Domain Sequences for d2yb8b_:
Sequence, based on SEQRES records: (download)
>d2yb8b_ b.69.4.1 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} veervineeykiwkkntpflydlvmthalewpsltaqwlpdvtkqdgkdysvhrlilgth tsdeqnhlliasvqlpsedaqfdgshydnekgefggfgsvcgkieieikinhegevnrar ympqnacviatktpssdvlvfdytkhpskpepsgecqpdlrlrghqkegyglswnpnlng yllsasddhticlwdinatpkehrvidakniftghtavvedvawhllheslfgsvaddqk lmiwdtrnnntskpshtvdahtaevnclsfnpysefilatgsadktvalwdlrnlklklh sfeshkdeifqvqwsphnetilassgtdrrlhvwdlskigeeqstedaedgppellfihg ghtakisdfswnpnepwiicsvsednimqvwqmaenvyn
>d2yb8b_ b.69.4.1 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} veervineeykiwkkntpflydlvmthalewpsltaqwlpdvtkqdgkdysvhrlilgth tsdeqnhlliasvqlpsgkieieikinhegevnrarympqnacviatktpssdvlvfdyt khpskpepsgecqpdlrlrghqkegyglswnpnlngyllsasddhticlwdinatpkehr vidakniftghtavvedvawhllheslfgsvaddqklmiwdtrnnntskpshtvdahtae vnclsfnpysefilatgsadktvalwdlrnlklklhsfeshkdeifqvqwsphnetilas sgtdrrlhvwdlskigeeqstedaedgppellfihgghtakisdfswnpnepwiicsvse dnimqvwqmaenvyn
Timeline for d2yb8b_: