Lineage for d2yb8b_ (2yb8 B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2065971Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2065972Family b.69.4.1: WD40-repeat [50979] (13 protein domains)
  6. 2066073Protein automated matches [190346] (4 species)
    not a true protein
  7. 2066091Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [311262] (1 PDB entry)
  8. 2066092Domain d2yb8b_: 2yb8 B: [304709]
    automated match to d3c9ca_
    complexed with so4

Details for d2yb8b_

PDB Entry: 2yb8 (more details), 2.3 Å

PDB Description: crystal structure of nurf55 in complex with su(z)12
PDB Compounds: (B:) probable histone-binding protein caf1

SCOPe Domain Sequences for d2yb8b_:

Sequence, based on SEQRES records: (download)

>d2yb8b_ b.69.4.1 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
veervineeykiwkkntpflydlvmthalewpsltaqwlpdvtkqdgkdysvhrlilgth
tsdeqnhlliasvqlpsedaqfdgshydnekgefggfgsvcgkieieikinhegevnrar
ympqnacviatktpssdvlvfdytkhpskpepsgecqpdlrlrghqkegyglswnpnlng
yllsasddhticlwdinatpkehrvidakniftghtavvedvawhllheslfgsvaddqk
lmiwdtrnnntskpshtvdahtaevnclsfnpysefilatgsadktvalwdlrnlklklh
sfeshkdeifqvqwsphnetilassgtdrrlhvwdlskigeeqstedaedgppellfihg
ghtakisdfswnpnepwiicsvsednimqvwqmaenvyn

Sequence, based on observed residues (ATOM records): (download)

>d2yb8b_ b.69.4.1 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
veervineeykiwkkntpflydlvmthalewpsltaqwlpdvtkqdgkdysvhrlilgth
tsdeqnhlliasvqlpsgkieieikinhegevnrarympqnacviatktpssdvlvfdyt
khpskpepsgecqpdlrlrghqkegyglswnpnlngyllsasddhticlwdinatpkehr
vidakniftghtavvedvawhllheslfgsvaddqklmiwdtrnnntskpshtvdahtae
vnclsfnpysefilatgsadktvalwdlrnlklklhsfeshkdeifqvqwsphnetilas
sgtdrrlhvwdlskigeeqstedaedgppellfihgghtakisdfswnpnepwiicsvse
dnimqvwqmaenvyn

SCOPe Domain Coordinates for d2yb8b_:

Click to download the PDB-style file with coordinates for d2yb8b_.
(The format of our PDB-style files is described here.)

Timeline for d2yb8b_:

  • d2yb8b_ is new in SCOPe 2.06-stable