PDB entry 2y9m

View 2y9m on RCSB PDB site
Description: Pex4p-Pex22p structure
Class: ligase/transport protein
Keywords: ligase-transport protein complex, ubiquitin conjugating enzyme, e2 complex, peroxisomal protein, alpha-beta-alpha sandwich fold, e2 co-activator
Deposited on 2011-02-15, released 2011-10-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin-conjugating enzyme e2-21 kda
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29340 (3-End)
      • expression tag (2)
      • engineered mutation (3)
    Domains in SCOPe 2.08: d2y9ma1, d2y9ma2
  • Chain 'B':
    Compound: peroxisome assembly protein 22
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2y9mA (A:)
    gamadtcmsrivkeykvilktlasddpianpyrgiieslnpidetdlskweaiisgpsdt
    pyenhqfrilievpssypmnppkisfmqnnilhcnvksatgeiclnilkpeewtpvwdll
    hcvhavwrllrepvcdspldvdigniircgdmsayqgivkyflaererinnh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y9mA (A:)
    madtcmsrivkeykvilktlasddpianpyrgiieslnpidetdlskweaiisgpsdtpy
    enhqfrilievpssypmnppkisfmqnnilhcnvksatgeiclnilkpeewtpvwdllhc
    vhavwrllrepvcdspldvdigniircgdmsayqgivkyflaerer
    

  • Chain 'B':
    No sequence available.