Lineage for d2y9ma1 (2y9m A:15-179)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2507728Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2507729Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2508149Family d.20.1.0: automated matches [191322] (1 protein)
    not a true family
  6. 2508150Protein automated matches [190120] (8 species)
    not a true protein
  7. 2508151Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226239] (1 PDB entry)
  8. 2508152Domain d2y9ma1: 2y9m A:15-179 [207502]
    Other proteins in same PDB: d2y9ma2
    automated match to d1x23d_
    complexed with edo

Details for d2y9ma1

PDB Entry: 2y9m (more details), 2.6 Å

PDB Description: pex4p-pex22p structure
PDB Compounds: (A:) ubiquitin-conjugating enzyme e2-21 kda

SCOPe Domain Sequences for d2y9ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y9ma1 d.20.1.0 (A:15-179) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
adtcmsrivkeykvilktlasddpianpyrgiieslnpidetdlskweaiisgpsdtpye
nhqfrilievpssypmnppkisfmqnnilhcnvksatgeiclnilkpeewtpvwdllhcv
havwrllrepvcdspldvdigniircgdmsayqgivkyflaerer

SCOPe Domain Coordinates for d2y9ma1:

Click to download the PDB-style file with coordinates for d2y9ma1.
(The format of our PDB-style files is described here.)

Timeline for d2y9ma1: