PDB entry 2y88

View 2y88 on RCSB PDB site
Description: crystal structure of mycobacterium tuberculosis phosphoribosyl isomerase (variant d11n) with bound prfar
Class: isomerase
Keywords: aromatic amino acid biosynthesis, isomerase, tim-barrel, histidine biosynthesis, tryptophan biosynthesis
Deposited on 2011-02-03, released 2011-03-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-03-16, with a file datestamp of 2011-03-11.
Experiment type: XRAY
Resolution: 1.33 Å
R-factor: 0.14
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phosphoribosyl isomerase a
  Species: Mycobacterium tuberculosis [TaxId:83332]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P60578 (0-243)
    • engineered mutation (9)
  Domains in SCOPe 2.06: d2y88a_
• Heterogens: 2ER, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2y88A (A:)
  mplillpavnvvegravrlvqgkagsqteygsavdaalgwqrdgaewihlvdldaafgrg
  snhellaevvgkldvqvelsggirddeslaaalatgcarvnvgtaalenpqwcarvigeh
  gdqvavgldvqiidgehrlrgrgwetdggdlwdvlerldsegcsrfvvtditkdgtlggp
  nldllagvadrtdapviasggvsslddlraiatlthrgvegaivgkalyarrftlpqala
  avrd