PDB entry 2xi8

View 2xi8 on RCSB PDB site
Description: high resolution structure of native cylr2
Class: transcription
Keywords: transcription, hth DNA-binding motif
Deposited on 2010-06-28, released 2011-02-09
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-05-25, with a file datestamp of 2011-05-20.
Experiment type: XRAY
Resolution: 1.21 Å
R-factor: 0.1367
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: putative transcription regulator
  Species: Enterococcus faecalis [TaxId:1351]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8VL32 (0-65)
  Domains in SCOPe 2.04: d2xi8a_
• Chain 'B':
  Compound: putative transcription regulator
  Species: Enterococcus faecalis [TaxId:1351]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8VL32 (0-65)
  Domains in SCOPe 2.04: d2xi8b_
• Heterogens: GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2xi8A (A:)
  miinnlklirekkkisqselaallevsrqtingieknkynpslqlalkiayylntpledi
  fqwqpe
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2xi8B (B:)
  miinnlklirekkkisqselaallevsrqtingieknkynpslqlalkiayylntpledi
  fqwqpe