PDB entry 2xdf

View 2xdf on RCSB PDB site
Description: solution structure of the enzyme I dimer complexed with hpr using residual dipolar couplings and small angle x-ray scattering
Class: transferase
Keywords: transferase, sugar transport
Deposited on 2010-04-30, released 2010-09-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-12-21, with a file datestamp of 2011-12-16.
Experiment type: NMR;SAXS
Resolution: N/A
R-factor: 0.44
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phosphoenolpyruvate-protein phosphotransferase
  Species: ESCHERICHIA COLI [TaxId:469008]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08839 (0-572)
• Chain 'B':
  Compound: Phosphoenolpyruvate-protein phosphotransferase
  Species: ESCHERICHIA COLI [TaxId:469008]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08839 (0-572)
• Chain 'C':
  Compound: Phosphocarrier protein HPr
  Species: ESCHERICHIA COLI [TaxId:469008]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AA06 (0-84)
  Domains in SCOPe 2.06: d2xdfc_
• Chain 'D':
  Compound: Phosphocarrier protein HPr
  Species: ESCHERICHIA COLI [TaxId:469008]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AA06 (0-84)
  Domains in SCOPe 2.06: d2xdfd_

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2xdfC (C:)
  mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
  vtisaegedeqkavehlvklmaele
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2xdfD (D:)
  mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
  vtisaegedeqkavehlvklmaele