PDB entry 2x7z

View 2x7z on RCSB PDB site
Description: crystal structure of the sap97 pdz2 i342w c378a mutant protein domain
Class: structural protein
Keywords: sh3 domain, phosphoprotein, synaptic protein, host-virus interaction, structural protein
Deposited on 2010-03-04, released 2010-03-31
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.19576
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Disks large homolog 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X7Z (0-1)
      • engineered mutation (33)
      • engineered mutation (69)
    • Uniprot Q12959 (2-98)
    Domains in SCOPe 2.02: d2x7za_
  • Heterogens: NH4, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2x7zA (A:)
gskpvsekimeiklikgpkglgfsiaggvgnqhwpgdnsiyvtkiieggaahkdgklqig
dkllavnnvaleevtheeavtalkntsdfvylkvakpts