PDB entry 2wm9

View 2wm9 on RCSB PDB site
Description: structure of the complex between dock9 and cdc42.
Class: cell cycle
Keywords: polymorphism, cell membrane, phosphoprotein, nucleotide-binding, alternative splicing, guanine-nucleotide releasing factor, cell cycle, methylation, lipoprotein, coiled coil, GTP-binding, gefs, dock9, cdc42, prenylation
Deposited on 2009-06-30, released 2009-09-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-09-22, with a file datestamp of 2009-09-18.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.2114
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dedicator of cytokinesis protein 9
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BZ29 (48-425)
    • PDB 2WM9 (426-End)
  • Chain 'B':
    Compound: Cell division control protein 42 homolog
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WM9 (0-1)
    • Uniprot P60953 (2-End)
    Domains in SCOPe 2.07: d2wm9b_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2wm9B (B:)
shmqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdt
agqedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqid
lrddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaale
ppepkksrrc

    Sequence, based on observed residues (ATOM records): (download) 
    >2wm9B (B:)
shmqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdt
agqedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqid
lrddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaal