PDB entry 2wfj

View 2wfj on RCSB PDB site
Description: atomic resolution crystal structure of the ppiase domain of human cyclophilin g in complex with cyclosporin a.
Class: isomerase/immunosuppressant
Keywords: isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, cyclosporin a, immunosuppressant, cyclophilin
Deposited on 2009-04-06, released 2009-06-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-11-23, with a file datestamp of 2011-11-18.
Experiment type: XRAY
Resolution: 0.75 Å
R-factor: 0.112
AEROSPACI score: 1.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptidyl-prolyl cis-trans isomerase g
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2wfja_
  • Chain 'B':
    Compound: cyclosporin a
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
  • Heterogens: EDO, MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2wfjA (A:)
gamgikvqrprcffdiainnqpagrvvfelfsdvcpktcenfrclctgekgtgkstqkpl
hyksclfhrvvkdfmvqggdfsegngrggesiyggffedesfavkhnkefllsmanrgkd
tngsqffittkptphldghhvvfgqvisgqevvreienqktdaaskpfaevrilscgel

    Sequence, based on observed residues (ATOM records): (download) 
    >2wfjA (A:)
qrprcffdiainnqpagrvvfelfsdvcpktcenfrclctgekgtgkstqkplhyksclf
hrvvkdfmvqggdfsegngrggesiyggffedesfavkhnkefllsmanrgkdtngsqff
ittkptphldghhvvfgqvisgqevvreienqktdaaskpfaevrilscgel

  • Chain 'B':
    No sequence available.