PDB entry 2w9q

View 2w9q on RCSB PDB site
Description: crystal structure of potato multicystatin-p212121
Class: hydrolase inhibitor
Keywords: protease inhibitor, thiol protease inhibitor, hydrolase inhibitor
Deposited on 2009-01-28, released 2010-02-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-02-02, with a file datestamp of 2010-01-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.193
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: multicystatin
  Species: Solanum tuberosum [TaxId:4113]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P37842 (0-86)
  Domains in SCOPe 2.07: d2w9qa_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2w9qA (A:)
  givnvpnpnntkfqelarfaiqdynkkqnahlefvenlnvkeqvvagimyyitlaatdda
  gkkkiykakiwvkewedfkkvvefklv