PDB entry 2w37

View 2w37 on RCSB PDB site
Description: crystal structure of the hexameric catabolic ornithine transcarbamylase from lactobacillus hilgardii
Class: transferase
Keywords: transcarbamylase, metal binding-site, hexamer, cytoplasm, ornithine, transferase, arginine metabolism, carbamoyl phosphate
Deposited on 2008-11-06, released 2009-11-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-11-17, with a file datestamp of 2009-11-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.198
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ornithine carbamoyltransferase, catabolic
    Species: LACTOBACILLUS HILGARDII [TaxId:1588]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W37
    • Uniprot Q8G998 (Start-358)
    Domains in SCOPe 2.07: d2w37a1, d2w37a2
  • Chain 'B':
    Compound: ornithine carbamoyltransferase, catabolic
    Species: LACTOBACILLUS HILGARDII [TaxId:1588]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W37
    • Uniprot Q8G998 (Start-358)
    Domains in SCOPe 2.07: d2w37b1, d2w37b2
  • Chain 'C':
    Compound: ornithine carbamoyltransferase, catabolic
    Species: LACTOBACILLUS HILGARDII [TaxId:1588]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W37
    • Uniprot Q8G998 (Start-358)
    Domains in SCOPe 2.07: d2w37c1, d2w37c2
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2w37A (A:)
    mggshhhhhhgddddkmtkdfrqnvfqgrsvlaekdfsaaeleylidfglhlkalkkagi
    phhylegkniallfeksstrtrsafttasidlgahpeylgqndiqlgkkestsdtakvlg
    smfdgiefrgfkqsdaeilardsgvpvwngltdewhptqmladfmtvkenfgklqgltlt
    fmgdgrnnvansllvtgailgvnihivapkalfpteetqniakgfaeksgaklvitddld
    eglkgsnvvytdvwvsmgesnweervkeltpyqvnmeamkktgtpddqlifmhclpafhn
    tdtqygkeikekygitemevtdevftskyarqfeeaenrmhsikammaatlgnlfiprv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w37A (A:)
    kdfrqnvfqgrsvlaekdfsaaeleylidfglhlkalkkagiphhylegkniallfekss
    trtrsafttasidlgahpeylgqndiqlgkkestsdtakvlgsmfdgiefrgfkqsdaei
    lardsgvpvwngltdewhptqmladfmtvkenfgklqgltltfmgdgrnnvansllvtga
    ilgvnihivapkalfpteetqniakgfaeksgaklvitddldeglkgsnvvytdvwvsmg
    esnweervkeltpyqvnmeamkktgtpddqlifmhclpafhntdtqygkeikekygitem
    evtdevftskyarqfeeaenrmhsikammaatlgnlfiprv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2w37B (B:)
    mggshhhhhhgddddkmtkdfrqnvfqgrsvlaekdfsaaeleylidfglhlkalkkagi
    phhylegkniallfeksstrtrsafttasidlgahpeylgqndiqlgkkestsdtakvlg
    smfdgiefrgfkqsdaeilardsgvpvwngltdewhptqmladfmtvkenfgklqgltlt
    fmgdgrnnvansllvtgailgvnihivapkalfpteetqniakgfaeksgaklvitddld
    eglkgsnvvytdvwvsmgesnweervkeltpyqvnmeamkktgtpddqlifmhclpafhn
    tdtqygkeikekygitemevtdevftskyarqfeeaenrmhsikammaatlgnlfiprv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w37B (B:)
    kdfrqnvfqgrsvlaekdfsaaeleylidfglhlkalkkagiphhylegkniallfekss
    trtrsafttasidlgahpeylgqndiqlgkkestsdtakvlgsmfdgiefrgfkqsdaei
    lardsgvpvwngltdewhptqmladfmtvkenfgklqgltltfmgdgrnnvansllvtga
    ilgvnihivapkalfpteetqniakgfaeksgaklvitddldeglkgsnvvytdvwvsmg
    esnweervkeltpyqvnmeamkktgtpddqlifmhclpafhntdtqygkeikekygitem
    evtdevftskyarqfeeaenrmhsikammaatlgnlfiprv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2w37C (C:)
    mggshhhhhhgddddkmtkdfrqnvfqgrsvlaekdfsaaeleylidfglhlkalkkagi
    phhylegkniallfeksstrtrsafttasidlgahpeylgqndiqlgkkestsdtakvlg
    smfdgiefrgfkqsdaeilardsgvpvwngltdewhptqmladfmtvkenfgklqgltlt
    fmgdgrnnvansllvtgailgvnihivapkalfpteetqniakgfaeksgaklvitddld
    eglkgsnvvytdvwvsmgesnweervkeltpyqvnmeamkktgtpddqlifmhclpafhn
    tdtqygkeikekygitemevtdevftskyarqfeeaenrmhsikammaatlgnlfiprv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w37C (C:)
    kdfrqnvfqgrsvlaekdfsaaeleylidfglhlkalkkagiphhylegkniallfekss
    trtrsafttasidlgahpeylgqndiqlgkkestsdtakvlgsmfdgiefrgfkqsdaei
    lardsgvpvwngltdewhptqmladfmtvkenfgklqgltltfmgdgrnnvansllvtga
    ilgvnihivapkalfpteetqniakgfaeksgaklvitddldeglkgsnvvytdvwvsmg
    esnweervkeltpyqvnmeamkktgtpddqlifmhclpafhntdtqygkeikekygitem
    evtdevftskyarqfeeaenrmhsikammaatlgnlfiprv