![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) ![]() |
![]() | Family c.78.1.0: automated matches [227206] (1 protein) not a true family |
![]() | Protein automated matches [226938] (26 species) not a true protein |
![]() | Species Lactobacillus hilgardii [TaxId:1588] [225787] (1 PDB entry) |
![]() | Domain d2w37b1: 2w37 B:3-156 [206583] automated match to d1dxha1 complexed with ni |
PDB Entry: 2w37 (more details), 2.1 Å
SCOPe Domain Sequences for d2w37b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w37b1 c.78.1.0 (B:3-156) automated matches {Lactobacillus hilgardii [TaxId: 1588]} kdfrqnvfqgrsvlaekdfsaaeleylidfglhlkalkkagiphhylegkniallfekss trtrsafttasidlgahpeylgqndiqlgkkestsdtakvlgsmfdgiefrgfkqsdaei lardsgvpvwngltdewhptqmladfmtvkenfg
Timeline for d2w37b1:
![]() Domains from other chains: (mouse over for more information) d2w37a1, d2w37a2, d2w37c1, d2w37c2 |