PDB entry 2vsm

View 2vsm on RCSB PDB site
Description: nipah virus attachment glycoprotein in complex with human cell surface receptor ephrinb2
Class: hydrolase
Keywords: developmental protein, henipavirus, neurogenesis, glycoprotein, paramyxovirus, envelope protein, cell surface receptor, hendra, virion, ephrin, complex, membrane, hydrolase, b2, efn, niv, eph, hev, hev-g, nipah, virus, niv-g, phosphoprotein, differentiation, viral attachment, signal-anchor, hemagglutinin, transmembrane
Deposited on 2008-04-25, released 2008-05-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-04-28, with a file datestamp of 2009-04-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.154
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemagglutinin-neuraminidase
    Species: Nipah virus [TaxId:121791]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9IH62 (0-414)
    • PDB 2VSM
  • Chain 'B':
    Compound: ephrin-b2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vsmb_
  • Heterogens: IPA, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vsmB (B:)
    ivlepiywnssnskflpgqglvlypqigdkldiicpkvdsktvgqyeyykvymvdkdqad
    rctikkentpllncakpdqdikftikfqefspnlwglefqknkdyyiistsngslegldn
    qeggvcqtramkilmkvghh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vsmB (B:)
    ivlepiywnssnskflpgqglvlypqigdkldiicpkvdvgqyeyykvymvdkdqadrct
    ikkentpllncakpdqdikftikfqefspnlwglefqknkdyyiistsngslegldnqeg
    gvcqtramkilmkvghh