PDB entry 2vlz

View 2vlz on RCSB PDB site
Description: crystal structure of peroxymyoglobin generated by cryoradiolytic reduction of myoglobin compound III
Class: oxygen transport
Keywords: haem, iron, heme, ferryl, transport, peroxidase, oxygen transport, oxygen activation, radiolytic- reduction, reaction intermediate, monooxygenase, metal-binding, muscle protein, x-ray-induced-photoreduction
Deposited on 2008-01-20, released 2008-01-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-06-08, with a file datestamp of 2011-06-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.164
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2vlza_
  • Heterogens: HEM, PER, SO4, GOL, PEO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vlzA (A:)
    glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
    lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
    gdfgadaqgamtkalelfrndiaakykelgfqg