| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein Myoglobin [46469] (11 species) |
| Species Horse (Equus caballus) [TaxId:9796] [46474] (96 PDB entries) |
| Domain d2vlza_: 2vlz A: [153310] automated match to d1azia_ complexed with gol, hem, peo, per, so4 |
PDB Entry: 2vlz (more details), 1.5 Å
SCOPe Domain Sequences for d2vlza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vlza_ a.1.1.2 (A:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfqg
Timeline for d2vlza_: