PDB entry 2vk3

View 2vk3 on RCSB PDB site
Description: crystal structure of rat profilin 2a
Class: protein-binding
Keywords: profilin, cytoplasm, acetylation, cytoskeleton, actin-binding, disulfide bridge, alternative splicing, protein-binding
Deposited on 2007-12-17, released 2009-02-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-04-07, with a file datestamp of 2009-04-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.175
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: profilin-2
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VK3 (0-1)
    • Uniprot Q9EPC6 (2-141)
    Domains in SCOPe 2.06: d2vk3a_
  • Heterogens: DTU, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vk3A (A:)
    gsmagwqsyvdnlmcdgccqeaaivgycdakyvwaataggvfqsitpaeidviigkdreg
    fftngltlggkkcsvirdslyvdsdctmdirtksqggeptynvavgragrvlvfvmgkeg
    vhggglnkkaysmakylrdsgf