PDB entry 2vj3
View 2vj3 on RCSB PDB site
Description: human notch-1 egfs 11-13
Class: transcription
Keywords: transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway, differentiation, phosphorylation, egf-like domain, transcription regulation, receptor, activator, ank repeat, signalling, glycoprotein, extracellular, egf, notch, jagged, nucleus, membrane
Deposited on
2007-12-06, released
2008-07-29
The last revision prior to the SCOPe 2.04 freeze date was dated
2010-08-25, with a file datestamp of
2010-08-20.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.239
AEROSPACI score: 0.25
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Neurogenic locus notch homolog protein 1
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- PDB 2VJ3 (118-End)
- conflict see remark 9 (68)
- Uniprot P46531 (2-117)
Domains in SCOPe 2.04: d2vj3a1, d2vj3a2, d2vj3a3 - Heterogens: CA, NA, CL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2vj3A (A:)
saqdvdecslganpcehagkcintlgsfecqclqgytgprceidvnecvsnpcqndatcl
dqigefqcicmpgyegvhcevntdecasspclhngrcldkinefqcecptgftghlcqvd
lhhildaqkmvwnhr
Sequence, based on observed residues (ATOM records): (download)
>2vj3A (A:)
qdvdecslganpcehagkcintlgsfecqclqgytgprceidvnecvsnpcqndatcldq
igefqcicmpgyegvhcevntdecasspclhngrcldkinefqcecptgftghlcqvdlh