PDB entry 2vac

View 2vac on RCSB PDB site
Description: structure of n-terminal actin depolymerizing factor homology (adf-h) domain of human twinfilin-2
Class: transferase
Keywords: transferase, actin binding, phosphorylation, cofilin-like, cytoskeleton, actin-binding, protein tyrosine kinase-9, actin depolymerizing factor transferase
Deposited on 2007-08-30, released 2007-10-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.172
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: twinfilin-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VAC (0-1)
    • Uniprot Q6IBS0 (2-133)
    Domains in SCOPe 2.04: d2vaca_
  • Heterogens: ZN, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2vacA (A:)
smgihateelkeffakaragsvrlikvviedeqlvlgasqepvgrwdqdydravlpllda
qqpcyllyrldsqnaqgfewlflawspdnspvrlkmlyaatratvkkefggghikdelfg
tvkddlsfagyqkh