PDB entry 2v1y

View 2v1y on RCSB PDB site
Description: structure of a phosphoinositide 3-kinase alpha adaptor-binding domain (abd) in a complex with the ish2 domain from p85 alpha
Class: transferase
Keywords: kinase, cancer, sh2 domain, sh3 domain, transferase, oncogenic mutations, host-virus interaction, phosphorylation, disease mutation, phosphoinositide, phospholipid, phospholipid signalling, phosphoinositide 3-kinase, signal transduction
Deposited on 2007-05-30, released 2007-07-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.236
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Phosphatidylinositol 3-kinase regulatory subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27986 (0-169)
      • conflict (20)
    Domains in SCOPe 2.07: d2v1yb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v1yB (B:)
    yqqdqvvkednieavgkklhkyntqfqeksreydrlyeeytrtsqeiqmkrtaieafnet
    ikifeeqcqtqeryskeyiekfkregnekeiqrimhnydklksriseiidsrrrleedlk
    kqaaeyreidkrmnsikpdliqlrktrdqylmwltqkgvrqkklnewlgn