PDB entry 2v0r

View 2v0r on RCSB PDB site
Description: crystal structure of a hairpin exchange variant (ltx) of the targeting line-1 retrotransposon endonuclease
Class: transcription
Keywords: ape-1 type, endonuclease, retrotransposition, retrotransposon, protein engineering, transcription
Deposited on 2007-05-17, released 2007-07-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.217
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ltx
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8TE30 (203-239)
    • PDB 2V0R (192-202)
    Domains in SCOPe 2.07: d2v0ra_
  • Chain 'B':
    Compound: ltx
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8TE30 (203-End)
    • PDB 2V0R (192-202)
    Domains in SCOPe 2.07: d2v0rb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2v0rA (A:)
    mtgsnshitiltlninglnsaikrhrlaswiksqdpsvcciqethltcrdthrlkikgwr
    kiyqangkqkkagvailvsdktdfkptkikrdkeghyimvkgsiqqeeltilniyapntg
    aprfikqvlsdlqrdldshtlimgdfntplstldrstrqkvnkdtqelnsalhqadlidi
    yrtlhpksteytyvrvrdghvsqskidhivgskallskckrteiitnylsdhsaiklelr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v0rA (A:)
    shitiltlninglnsaikrhrlaswiksqdpsvcciqethltcrdthrlkikgwrkiyqa
    ngkqkkagvailvsdktdfkptkikrdkeghyimvkgsiqqeeltilniyapntgaprfi
    kqvlsdlqrdldshtlimgdfntplstldrstrqkvnkdtqelnsalhqadlidiyrtlh
    pksteytyvrvrdghvsqskidhivgskallskckrteiitnylsdhsaiklelr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2v0rB (B:)
    mtgsnshitiltlninglnsaikrhrlaswiksqdpsvcciqethltcrdthrlkikgwr
    kiyqangkqkkagvailvsdktdfkptkikrdkeghyimvkgsiqqeeltilniyapntg
    aprfikqvlsdlqrdldshtlimgdfntplstldrstrqkvnkdtqelnsalhqadlidi
    yrtlhpksteytyvrvrdghvsqskidhivgskallskckrteiitnylsdhsaiklelr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v0rB (B:)
    shitiltlninglnsaikrhrlaswiksqdpsvcciqethltcrdthrlkikgwrkiyqa
    ngkqkkagvailvsdktdfkptkikrdkeghyimvkgsiqqeeltilniyapntgaprfi
    kqvlsdlqrdldshtlimgdfntplstldrstrqkvnkdtqelnsalhqadlidiyrtlh
    pksteytyvrvrdghvsqskidhivgskallskckrteiitnylsdhsaiklel