PDB entry 2ugi

View 2ugi on RCSB PDB site
Description: protein mimicry of DNA from crystal structures of the uracil glycosylase inhibitor protein and its complex with escherichia coli uracil-DNA glycosylase
Class: hydrolase inhibitor
Keywords: protein mimicry of DNA, protein inhibitor, hydrolase inhibitor
Deposited on 1998-11-06, released 1999-03-25
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.227
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uracil-DNA glycosylase inhibitor
    Species: Bacillus phage PBS2 [TaxId:10684]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2ugia_
  • Chain 'B':
    Compound: uracil-DNA glycosylase inhibitor
    Species: Bacillus phage PBS2 [TaxId:10684]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2ugib_
  • Heterogens: IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2ugiA (A:)
mtnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmllts
dapeykpwalviqdsngenkikml

    Sequence, based on observed residues (ATOM records): (download) 
    >2ugiA (A:)
tnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsd
apeykpwalviqdsngenkikml

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2ugiB (B:)
mtnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmllts
dapeykpwalviqdsngenkikml

    Sequence, based on observed residues (ATOM records): (download) 
    >2ugiB (B:)
tnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsd
apeykpwalviqdsngenkikml