PDB entry 2spl

View 2spl on RCSB PDB site
Description: a novel site-directed mutant of myoglobin with an unusually high o2 affinity and low autooxidation rate
Deposited on 1993-08-25, released 1994-01-31
The last revision prior to the SCOP 1.63 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.7 Å
R-factor: 0.152
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.63: d2spl__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2spl_ (-)
  mvlsegewqlvlhvwakveadvaghgqdifirlfkshpetlekfdrfkhlkteaemkase
  dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
  pgnfgadaqgamnkalelfrkdiaakykelgyqg