PDB entry 2rsg

View 2rsg on RCSB PDB site
Description: Solution structure of the CERT PH domain
Class: lipid transport
Keywords: pleckstrin homology, LIPID TRANSPORT
Deposited on 2012-02-25, released 2012-08-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-10-16, with a file datestamp of 2013-10-11.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Collagen type IV alpha-3-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: COL4A3BP, CERT, STARD11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2rsga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rsgA (A:)
    vercgvlskwtnyihgwqdrwvvlknnalsyyksedeteygcrgsiclskavitphdfde
    crfdisvndsvwylraqdpdhrqqwidaieqhkt