PDB entry 2rrb

View 2rrb on RCSB PDB site
Description: Refinement of RNA binding domain in human Tra2 beta protein
Class: RNA binding protein
Keywords: RRM domain, RBD, RNA binding protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2010-06-17, released 2011-04-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-04-27, with a file datestamp of 2011-04-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cDNA FLJ40872 fis, clone TUTER2000283, highly similar to Homo sapiens transformer-2-beta (SFRS10) gene
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8N1H4 (5-95)
      • expression tag (0-4)
    Domains in SCOPe 2.04: d2rrba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2rrbA (A:)
gplgsranpdpncclgvfglslytterdlrevfskygpiadvsivydqqsrrsrgfafvy
fenvddakeakerangmeldgrrirvdfsitkrpht