PDB entry 2rqb

View 2rqb on RCSB PDB site
Description: Solution structure of MDA5 CTD
Class: hydrolase
Keywords: RNA binding protein, HYDROLASE, Alternative splicing, Antiviral defense, ATP-binding, Cytoplasm, Diabetes mellitus, Helicase, Host-virus interaction, Immune response, Innate immunity, Nucleotide-binding, Nucleus, Phosphoprotein, Polymorphism, RNA-binding
Deposited on 2009-03-17, released 2009-05-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-07-07, with a file datestamp of 2009-07-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interferon-induced helicase C domain-containing protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: IFIH1, MDA5, RH116
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BYX4 (5-134)
      • expression tag (0-4)
    Domains in SCOPe 2.07: d2rqba1, d2rqba2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rqbA (A:)
    gplgsyknnpslitflckncsvlacsgedihviekmhhvnmtpefkelyivrenkalqkk
    cadyqingeiickcgqawgtmmvhkgldlpclkirnfvvvfknnstkkqykkwvelpitf
    pnldysecclfsded