PDB entry 2rqa

View 2rqa on RCSB PDB site
Description: Solution structure of LGP2 CTD
Class: hydrolase
Keywords: RNA binding protein, ATP-binding, Coiled coil, Cytoplasm, Helicase, Hydrolase, Immune response, Innate immunity, Nucleotide-binding, Polymorphism, RNA-binding
Deposited on 2009-03-17, released 2009-05-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-07-07, with a file datestamp of 2009-07-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent RNA helicase DHX58
    Species: Homo sapiens [TaxId:9606]
    Gene: DHX58, D11LGP2E, LGP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96C10 (4-136)
      • expression tag (0-3)
    Domains in SCOPe 2.08: d2rqaa1, d2rqaa2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rqaA (A:)
    gphmqfpvehvqllcincmvavghgsdlrkvegthhvnvnpnfsnyynvsrdpvvinkvf
    kdwkpggviscrncgevwglqmiyksvklpvlkvrsmlletpqgriqakkwsrvpfsvpd
    fdflqhcaenlsdlsld