PDB entry 2rot

View 2rot on RCSB PDB site
Description: Structure of chimeric variant of SH3 domain- SHH
Class: protein binding
Keywords: SH3, chimeric protein, alpha-spectrin, Actin capping, Actin-binding, Calcium, Calmodulin-binding, Cytoplasm, Cytoskeleton, Phosphoprotein, SH3 domain, PROTEIN BINDING
Deposited on 2008-04-10, released 2009-04-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-26, with a file datestamp of 2020-02-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Spectrin alpha chain, brain
    Species: Gallus gallus [TaxId:9031]
    Gene: SPTAN1, SPTA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07751 (1-69)
      • initiating methionine (0)
      • see remark 999 (46-55)
    Domains in SCOPe 2.08: d2rota_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2rotA (A:)
mdetgkelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevkitvngktyerqgf
vpaayvkkld