Lineage for d2rota_ (2rot A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2782886Protein alpha-Spectrin, SH3 domain [50058] (1 species)
  7. 2782887Species Chicken (Gallus gallus) [TaxId:9031] [50059] (38 PDB entries)
  8. 2782919Domain d2rota_: 2rot A: [243740]
    automated match to d2f2va_

Details for d2rota_

PDB Entry: 2rot (more details)

PDB Description: structure of chimeric variant of sh3 domain- shh
PDB Compounds: (A:) Spectrin alpha chain, brain

SCOPe Domain Sequences for d2rota_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rota_ b.34.2.1 (A:) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]}
mdetgkelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevkitvngktyerqgf
vpaayvkkld

SCOPe Domain Coordinates for d2rota_:

Click to download the PDB-style file with coordinates for d2rota_.
(The format of our PDB-style files is described here.)

Timeline for d2rota_: