PDB entry 2rlk

View 2rlk on RCSB PDB site
Description: Refined solution structure of porcine peptide YY (PYY)
Class: hormone
Keywords: peptide hormone, helical hairpin, Amidation
Deposited on 2007-07-21, released 2007-08-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Peptide YY
  Species: Sus scrofa [TaxId:9823]
  Gene: PYY
  Database cross-references and differences (RAF-indexed):
  • Uniprot P68005 (0-35)
  Domains in SCOPe 2.04: d2rlka1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2rlkA (A:)
  ypakpeapgedaspeelsryyaslrhylnlvtrqry