PDB entry 2rky
View 2rky on RCSB PDB site
Description: Crystal structure of the fourth and fifth fibronectin F1 modules in complex with a fragment of staphylococcus aureus fnbpa-1
Class: cell adhesion
Keywords: Fibronectin, 4F15F1, Beta zipper, Staphylococcus aureus, Acute phase, Alternative splicing, Cell adhesion, Extracellular matrix, Glycoprotein, Heparin-binding, Phosphorylation, Pyrrolidone carboxylic acid, Secreted, Sulfation, Cell wall, Peptidoglycan-anchor, Virulence
Deposited on
2007-10-18, released
2008-08-05
The last revision prior to the SCOPe 2.04 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.183
AEROSPACI score: 0.51
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Fibronectin
Species: Homo sapiens [TaxId:9606]
Gene: FN1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d2rkya1, d2rkya2 - Chain 'B':
Compound: Fibronectin-binding protein
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'C':
Compound: Fibronectin
Species: Homo sapiens [TaxId:9606]
Gene: FN1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d2rkyc1, d2rkyc2 - Chain 'D':
Compound: Fibronectin-binding protein
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: SCN, K, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2rkyA (A:)
aekcfdhaagtsyvvgetwekpyqgwmmvdctclgegsgritctsrnrcndqdtrtsyri
gdtwskkdnrgnllqcictgngrgewkcerhts
Sequence, based on observed residues (ATOM records): (download)
>2rkyA (A:)
aekcfdhaagtsyvvgetwekpyqgwmmvdctclgegsgritctsrnrcndqdtrtsyri
gdtwskkdnrgnllqcictgngrgewkcer
- Chain 'B':
No sequence available.
- Chain 'C':
Sequence, based on SEQRES records: (download)
>2rkyC (C:)
aekcfdhaagtsyvvgetwekpyqgwmmvdctclgegsgritctsrnrcndqdtrtsyri
gdtwskkdnrgnllqcictgngrgewkcerhts
Sequence, based on observed residues (ATOM records): (download)
>2rkyC (C:)
aekcfdhaagtsyvvgetwekpyqgwmmvdctclgegsgritctsrnrcndqdtrtsyri
gdtwskkdnrgnllqcictgngrgewkcerht
- Chain 'D':
No sequence available.