PDB entry 2rky

View 2rky on RCSB PDB site
Description: Crystal structure of the fourth and fifth fibronectin F1 modules in complex with a fragment of staphylococcus aureus fnbpa-1
Class: cell adhesion
Keywords: Fibronectin, 4F15F1, Beta zipper, Staphylococcus aureus, Acute phase, Alternative splicing, Cell adhesion, Extracellular matrix, Glycoprotein, Heparin-binding, Phosphorylation, Pyrrolidone carboxylic acid, Secreted, Sulfation, Cell wall, Peptidoglycan-anchor, Virulence
Deposited on 2007-10-18, released 2008-08-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibronectin
    Species: Homo sapiens [TaxId:9606]
    Gene: FN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2rkya1, d2rkya2
  • Chain 'B':
    Compound: Fibronectin-binding protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Fibronectin
    Species: Homo sapiens [TaxId:9606]
    Gene: FN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2rkyc1, d2rkyc2
  • Chain 'D':
    Compound: Fibronectin-binding protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SCN, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2rkyA (A:)
aekcfdhaagtsyvvgetwekpyqgwmmvdctclgegsgritctsrnrcndqdtrtsyri
gdtwskkdnrgnllqcictgngrgewkcerhts

    Sequence, based on observed residues (ATOM records): (download) 
    >2rkyA (A:)
aekcfdhaagtsyvvgetwekpyqgwmmvdctclgegsgritctsrnrcndqdtrtsyri
gdtwskkdnrgnllqcictgngrgewkcer

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >2rkyC (C:)
aekcfdhaagtsyvvgetwekpyqgwmmvdctclgegsgritctsrnrcndqdtrtsyri
gdtwskkdnrgnllqcictgngrgewkcerhts

    Sequence, based on observed residues (ATOM records): (download) 
    >2rkyC (C:)
aekcfdhaagtsyvvgetwekpyqgwmmvdctclgegsgritctsrnrcndqdtrtsyri
gdtwskkdnrgnllqcictgngrgewkcerht

  • Chain 'D':
    No sequence available.