Lineage for d2rkyc1 (2rky C:152-197)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034865Fold g.27: FnI-like domain [57602] (1 superfamily)
    disulfide-rich, all-beta
  4. 3034866Superfamily g.27.1: FnI-like domain [57603] (3 families) (S)
  5. 3034867Family g.27.1.1: Fibronectin type I module [57604] (2 proteins)
    automatically mapped to Pfam PF00039
  6. 3034868Protein Fibronectin [57605] (1 species)
  7. 3034869Species Human (Homo sapiens) [TaxId:9606] [57606] (12 PDB entries)
  8. 3034892Domain d2rkyc1: 2rky C:152-197 [152114]
    automatically matched to d1fbra1
    complexed with k, scn

Details for d2rkyc1

PDB Entry: 2rky (more details), 1.8 Å

PDB Description: crystal structure of the fourth and fifth fibronectin f1 modules in complex with a fragment of staphylococcus aureus fnbpa-1
PDB Compounds: (C:) Fibronectin

SCOPe Domain Sequences for d2rkyc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rkyc1 g.27.1.1 (C:152-197) Fibronectin {Human (Homo sapiens) [TaxId: 9606]}
aekcfdhaagtsyvvgetwekpyqgwmmvdctclgegsgritctsr

SCOPe Domain Coordinates for d2rkyc1:

Click to download the PDB-style file with coordinates for d2rkyc1.
(The format of our PDB-style files is described here.)

Timeline for d2rkyc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2rkyc2