PDB entry 2rhk

View 2rhk on RCSB PDB site
Description: Crystal structure of influenza A NS1A protein in complex with F2F3 fragment of human cellular factor CPSF30, Northeast Structural Genomics Targets OR8C and HR6309A
Class: viral protein/nuclear protein
Keywords: Influenza A, Nonstructural protein, viral protein: host complex, Zn finger, Alternative splicing, Cytoplasm, Host-virus interaction, Interferon antiviral system evasion, Nucleus, RNA-binding, Suppressor of RNA silencing, Metal-binding, mRNA processing, Zinc, Zinc-finger, METAL BINDING PROTEIN, VIRAL PROTEIN-METAL BINDING PROTEIN COMPLEX, VIRAL PROTEIN-NUCLEAR PROTEIN COMPLEX, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG
Deposited on 2007-10-09, released 2008-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-03-31, with a file datestamp of 2010-03-26.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Non-structural protein 1
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rhka_
  • Chain 'B':
    Compound: Non-structural protein 1
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rhkb_
  • Chain 'C':
    Compound: Cleavage and polyadenylation specificity factor subunit 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95639 (11-End)
      • expression tag (6-10)
      • engineered (44)
  • Chain 'D':
    Compound: Cleavage and polyadenylation specificity factor subunit 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95639 (11-End)
      • expression tag (8-10)
      • engineered (44)
  • Heterogens: NO3, ZN, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rhkA (A:)
    mpasryitdmtieelsrdwfmlmpkqkvegplciridqaimdknimlkanfsvifdrlet
    lillrafteegaivgeisplpsfpghtiedvknaigvligglewndntvrvsktlqrfaw
    gssnengrppltlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rhkA (A:)
    pasryitdmtieelsrdwfmlmpkqkvegplciridqaimdknimlkanfsvifdrletl
    illrafteegaivgeisplpsfpghtiedvknaigvligglewndntvrvsktlqrfaw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2rhkB (B:)
    mpasryitdmtieelsrdwfmlmpkqkvegplciridqaimdknimlkanfsvifdrlet
    lillrafteegaivgeisplpsfpghtiedvknaigvligglewndntvrvsktlqrfaw
    gssnengrppltlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rhkB (B:)
    pasryitdmtieelsrdwfmlmpkqkvegplciridqaimdknimlkanfsvifdrletl
    illrafteegaivgeisplpsfpghtiedvknaigvligglewndntvrvsktlqrfaw
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.