PDB entry 2r6w

View 2r6w on RCSB PDB site
Description: Estrogen receptor alpha ligand-binding domain complexed to a SERM
Class: transcription
Keywords: estrogen receptor, ligand-binding domain, Alternative splicing, DNA-binding, Lipid-binding, Metal-binding, Nucleus, Phosphorylation, Polymorphism, Steroid-binding, Transcription, Transcription regulation, Zinc, Zinc-finger
Deposited on 2007-09-06, released 2008-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.212
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered (77)
      • engineered (113)
    Domains in SCOPe 2.07: d2r6wa_
  • Chain 'B':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered (77)
      • engineered (113)
    Domains in SCOPe 2.07: d2r6wb_
  • Heterogens: LLB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r6wA (A:)
    nslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakr
    vpgfvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmve
    ifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkit
    dtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvplydlllem
    ldahrlha
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r6wA (A:)
    lalsltadqmvsalldaeppilyseyasmmglltnladrelvhminwakrvpgfvdltlh
    dqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifdmllatss
    rfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtlihlmaka
    gltlqqqhqrlaqlllilshirhmsnkgmehlyvplydlllemldahrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2r6wB (B:)
    nslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakr
    vpgfvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmve
    ifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkit
    dtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvplydlllem
    ldahrlha
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r6wB (B:)
    lalsltadqmvsalldaeppilyseyasmmglltnladrelvhminwakrvpgfvdltlh
    dqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifdmllatss
    rfrmmnlqgeefvclksiillnsgvytfstlksleekdhihrvldkitdtlihlmakagl
    tlqqqhqrlaqlllilshirhmsnkgmehlyplydlllemlda