Lineage for d2r6wb_ (2r6w B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008578Protein Estrogen receptor alpha [48519] (1 species)
  7. 2008579Species Human (Homo sapiens) [TaxId:9606] [48520] (64 PDB entries)
    Uniprot P03372 307-551
  8. 2008614Domain d2r6wb_: 2r6w B: [151622]
    automated match to d1qkta_
    protein/DNA complex; complexed with llb

Details for d2r6wb_

PDB Entry: 2r6w (more details), 2 Å

PDB Description: Estrogen receptor alpha ligand-binding domain complexed to a SERM
PDB Compounds: (B:) Estrogen receptor

SCOPe Domain Sequences for d2r6wb_:

Sequence, based on SEQRES records: (download)

>d2r6wb_ a.123.1.1 (B:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
gfvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveif
dmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdt
lihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvplydlllemld
a

Sequence, based on observed residues (ATOM records): (download)

>d2r6wb_ a.123.1.1 (B:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
lalsltadqmvsalldaeppilyseyasmmglltnladrelvhminwakrvpgfvdltlh
dqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifdmllatss
rfrmmnlqgeefvclksiillnsgvytfstlksleekdhihrvldkitdtlihlmakagl
tlqqqhqrlaqlllilshirhmsnkgmehlyplydlllemlda

SCOPe Domain Coordinates for d2r6wb_:

Click to download the PDB-style file with coordinates for d2r6wb_.
(The format of our PDB-style files is described here.)

Timeline for d2r6wb_: