PDB entry 2r32

View 2r32 on RCSB PDB site
Description: Crystal Structure of human GITRL variant
Class: immune system
Keywords: GITRL, Glucocorticoid-Induced TNF Receptor Ligand, Cytokine, Glycoprotein, Membrane, Signal-anchor, Transmembrane, IMMUNE SYSTEM
Deposited on 2007-08-28, released 2007-11-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: -1.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GCN4-pII/Tumor necrosis factor ligand superfamily member 18 fusion protein
    Species: , [TaxId:4932,9606]
    Gene: TNFSF18, AITRL, GITRL, TL6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2r32a1
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2r32A (A:)
gshmggsrmkqiedkieeilskiyhieneiarikkligeretakepcmakfgplpskwqm
asseppcvnkvsdwkleilqnglyliygqvapnanyndvapfevrlyknkdmiqtltnks
kiqnvggtyelhvgdtidlifnsehqvlknntywgiillanpqfis

    Sequence, based on observed residues (ATOM records): (download) 
    >2r32A (A:)
rmkqiedkieeilskiyhieneiarikklpcmakfgplpskwqmappcvnkvsdwkleil
qnglyliygqvapnapfevrlyknkdmiqtltnkskiqnvggtyelhvgdtidlifnseh
qvlknntywgiillanpqfi