![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.22.1: TNF-like [49842] (2 families) ![]() |
![]() | Family b.22.1.1: TNF-like [49843] (15 proteins) |
![]() | Protein Glucocorticoid-induced TNF-related ligand, TNFSF18 [158982] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [158984] (6 PDB entries) Uniprot Q9UNG2 55-177! Uniprot Q9UNG2 57-172! Uniprot Q9UNG2 57-176 |
![]() | Domain d2r32a1: 2r32 A:57-176 [151547] chimera with a GCN4 helix (excluded) complexed with so4 |
PDB Entry: 2r32 (more details), 1.95 Å
SCOPe Domain Sequences for d2r32a1:
Sequence, based on SEQRES records: (download)
>d2r32a1 b.22.1.1 (A:57-176) Glucocorticoid-induced TNF-related ligand, TNFSF18 {Human (Homo sapiens) [TaxId: 9606]} pcmakfgplpskwqmasseppcvnkvsdwkleilqnglyliygqvapnanyndvapfevr lyknkdmiqtltnkskiqnvggtyelhvgdtidlifnsehqvlknntywgiillanpqfi
>d2r32a1 b.22.1.1 (A:57-176) Glucocorticoid-induced TNF-related ligand, TNFSF18 {Human (Homo sapiens) [TaxId: 9606]} pcmakfgplpskwqmappcvnkvsdwkleilqnglyliygqvapnapfevrlyknkdmiq tltnkskiqnvggtyelhvgdtidlifnsehqvlknntywgiillanpqfi
Timeline for d2r32a1: