PDB entry 2r2r

View 2r2r on RCSB PDB site
Description: d(ATTAGTTATAACTAAT) complexed with MMLV RT catalytic fragment
Class: transferase/DNA
Keywords: bleomycin, drug-DNA complex, protein-DNA complex, MMLV RT, Aspartyl protease, DNA recombination, Endonuclease, Multifunctional enzyme, Nuclease, Nucleotidyltransferase, RNA-directed DNA polymerase, transferase-DNA COMPLEX
Deposited on 2007-08-27, released 2008-07-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: reverse transcriptase
    Species: Moloney murine leukemia virus [TaxId:11801]
    Gene: pol
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2r2ra_
  • Chain 'B':
    Compound: DNA (5'-d(*dap*dtp*dtp*dap*dgp*dtp*dtp*da)-3')
  • Chain 'G':
    Compound: DNA (5'-d(p*dtp*dap*dap*dcp*dtp*dap*dap*dt)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2r2rA (A:)
    twlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiqrlld
    qgilvpcqspwntpllpvkkpgtndyrpvqdlrevnkrvedihptvpnpynllsglppsh
    qwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlfdeal
    hrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakkaqicq
    kqvkylgyllkegqr
    

  • Chain 'B':
    No sequence available.

  • Chain 'G':
    No sequence available.