PDB entry 2qqd
View 2qqd on RCSB PDB site
Description: N47A mutant of Pyruvoyl-dependent Arginine Decarboxylase from Methanococcus jannashii
Class: lyase
Keywords: arginine decarboxylase, pyruvoyl, decarboxylation, autoprocessing, serinolysis, Lyase, Pyruvate
Deposited on
2007-07-26, released
2008-03-18
The last revision prior to the SCOPe 2.06 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.212
AEROSPACI score: 0.43
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Pyruvoyl-dependent arginine decarboxylase (EC 4.1.1.19) (PvlArgDC)
Species: Methanocaldococcus jannaschii [TaxId:2190]
Gene: pdaD
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: Pyruvoyl-dependent arginine decarboxylase (EC 4.1.1.19) (PvlArgDC)
Species: Methanocaldococcus jannaschii [TaxId:2190]
Gene: pdaD
Database cross-references and differences (RAF-indexed):
- Chain 'C':
Compound: Pyruvoyl-dependent arginine decarboxylase (EC 4.1.1.19) (PvlArgDC)
Species: Methanocaldococcus jannaschii [TaxId:2190]
Gene: pdaD
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d2qqdc_ - Chain 'D':
Compound: Pyruvoyl-dependent arginine decarboxylase (EC 4.1.1.19) (PvlArgDC)
Species: Methanocaldococcus jannaschii [TaxId:2190]
Gene: pdaD
Database cross-references and differences (RAF-indexed):
- Chain 'E':
Compound: Pyruvoyl-dependent arginine decarboxylase (EC 4.1.1.19) (PvlArgDC)
Species: Methanocaldococcus jannaschii [TaxId:2190]
Gene: pdaD
Database cross-references and differences (RAF-indexed):
- Chain 'F':
Compound: Pyruvoyl-dependent arginine decarboxylase (EC 4.1.1.19) (PvlArgDC)
Species: Methanocaldococcus jannaschii [TaxId:2190]
Gene: pdaD
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d2qqdf_ - Chain 'G':
Compound: Pyruvoyl-dependent arginine decarboxylase (EC 4.1.1.19) (PvlArgDC)
Species: Methanocaldococcus jannaschii [TaxId:2190]
Gene: pdaD
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d2qqdg_ - Chain 'H':
Compound: Pyruvoyl-dependent arginine decarboxylase (EC 4.1.1.19) (PvlArgDC)
Species: Methanocaldococcus jannaschii [TaxId:2190]
Gene: pdaD
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d2qqdh_ - Heterogens: AG2, PYR, MPD, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
No sequence available.
- Chain 'C':
Sequence, based on SEQRES records: (download)
>2qqdC (C:)
hmnaeinplhayfklpntvslvagssegetplnafdgallnagignvalirissimppea
eivplpklpmgalvptaygyiisdvpgetisaaisvaipkdkslcglimeyegkcskkea
ektvremakigfemrgweldriesiavehtveklgcafaaaalwyk
Sequence, based on observed residues (ATOM records): (download)
>2qqdC (C:)
plhayfklpntvslvagssegetplnafdgallnagignvalirissimppeaeivplpk
lpmgalvptaygyiisdvpgetisaaisvaipkdkslcglimeyegkcskkeaektvrem
akigfemrgweldriesiavehtveklgcafaaaalwyk
- Chain 'D':
No sequence available.
- Chain 'E':
No sequence available.
- Chain 'F':
Sequence, based on SEQRES records: (download)
>2qqdF (F:)
hmnaeinplhayfklpntvslvagssegetplnafdgallnagignvalirissimppea
eivplpklpmgalvptaygyiisdvpgetisaaisvaipkdkslcglimeyegkcskkea
ektvremakigfemrgweldriesiavehtveklgcafaaaalwyk
Sequence, based on observed residues (ATOM records): (download)
>2qqdF (F:)
lpntvslvagssegetplnafdgallnagignvalirissimppeaeivplpklpmgalv
ptaygyiisdvpgetisaaisvaipkdkslcglimeyegkcskkeaektvremakigfem
rgweldriesiavehtveklgcafaaaalwyk
- Chain 'G':
Sequence, based on SEQRES records: (download)
>2qqdG (G:)
hmnaeinplhayfklpntvslvagssegetplnafdgallnagignvalirissimppea
eivplpklpmgalvptaygyiisdvpgetisaaisvaipkdkslcglimeyegkcskkea
ektvremakigfemrgweldriesiavehtveklgcafaaaalwyk
Sequence, based on observed residues (ATOM records): (download)
>2qqdG (G:)
lpntvslvagssegetplnafdgallnagignvalirissimppeaeivplpklpmgalv
ptaygyiisdvpgetisaaisvaipkdkslcglimeyegkcskkeaektvremakigfem
rgweldriesiavehtveklgcafaaaalwyk
- Chain 'H':
Sequence, based on SEQRES records: (download)
>2qqdH (H:)
hmnaeinplhayfklpntvslvagssegetplnafdgallnagignvalirissimppea
eivplpklpmgalvptaygyiisdvpgetisaaisvaipkdkslcglimeyegkcskkea
ektvremakigfemrgweldriesiavehtveklgcafaaaalwyk
Sequence, based on observed residues (ATOM records): (download)
>2qqdH (H:)
klpntvslvagssegetplnafdgallnagignvalirissimppeaeivplpklpmgal
vptaygyiisdvpgetisaaisvaipkdkslcglimeyegkcskkeaektvremakigfe
mrgweldriesiavehtveklgcafaaaalwyk